PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc06g034340.1.1
Common NameLOC101246350
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 341aa    MW: 39497.3 Da    PI: 6.7048
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc06g034340.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.74.5e-5371361129
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeek.ewyfFskrdkkyatgkrknratksgyWkatgk 88 
                         +ppGfrFhPtdeelv++yL+kk+++++++l +vik++d+yk+ePwdL++  ++ +ee+ +wyfFs++dkky+tg+r+nrat++g+Wkatg+
  Solyc06g034340.1.1   7 VPPGFRFHPTDEELVDYYLRKKITSRRIDL-DVIKDIDLYKIEPWDLQElcRMGTEEQsDWYFFSHKDKKYPTGTRTNRATAAGFWKATGR 96 
                         69****************************.9***************954555554445******************************** PP

                 NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                         dk+++s k+ l+g++ktLv+ykgrap+g+k+d +mheyrle
  Solyc06g034340.1.1  97 DKAIYS-KHDLIGMRKTLVYYKGRAPNGQKSDFIMHEYRLE 136
                         ******.8899****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-585156IPR003441NAC domain
PROSITE profilePS5100556.8667156IPR003441NAC domain
PfamPF023653.7E-278135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MNSLSHVPPG FRFHPTDEEL VDYYLRKKIT SRRIDLDVIK DIDLYKIEPW DLQELCRMGT  60
EEQSDWYFFS HKDKKYPTGT RTNRATAAGF WKATGRDKAI YSKHDLIGMR KTLVYYKGRA  120
PNGQKSDFIM HEYRLETDPN GAPQEEGWVI CRVFKKKIAA GMRMDTSEHG SPIWYDDQLS  180
FMQDMDSPKP IHPQMNYINH YPNNYPNCKK EFDNLQYQTP PQNHQFLHQL PLLETNKLVA  240
APPGCSSIPI FGNIRPALVT QDPHVHPTFE NQQVADQVTD WRVLHKLVAS QLSQEDENNN  300
YSSPNTFQAK RDDEVNLNKQ EMAPENTSTA SSTSQIDLWK *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A9e-48615714169Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00136DAPTransfer from AT1G12260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004240802.10.0PREDICTED: NAC domain-containing protein 7-like
SwissprotQ9FWX21e-131NAC7_ARATH; NAC domain-containing protein 7
TrEMBLK4C4Q50.0K4C4Q5_SOLLC; Uncharacterized protein
STRINGSolyc06g034340.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.11e-120NAC 007
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]